PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 449aa    MW: 51039.4 Da    PI: 6.5121
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2485genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-18211257148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd  l+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
      Gh_A12G2485 211 KGQWTMEEDRMLIQLVEQYGVRKWSHIAQMLP-GRIGKQCRERWHNHL 257
                      799*****************************.*************97 PP

2Myb_DNA-binding54.82.2e-17263305145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd+ l++a+ + G++ W+ Ia++++ gRt++++k++w+
      Gh_A12G2485 263 KDTWSEEEDKVLIQAHIEIGNK-WAEIAKRLP-GRTENSIKNHWN 305
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.007206261IPR017930Myb domain
SMARTSM007175.0E-17210259IPR001005SANT/Myb domain
SuperFamilySSF466891.55E-31210304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-26212262IPR009057Homeodomain-like
CDDcd001671.09E-15214257No hitNo description
PfamPF139211.8E-19214272No hitNo description
SMARTSM007172.2E-16262310IPR001005SANT/Myb domain
PROSITE profilePS5129420.483262312IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-21263310IPR009057Homeodomain-like
CDDcd001671.59E-12265308No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MAKRYFTLVL VLIASSMEFD PKLRENMSPQ HQHHPMMLSE NNILKPLQTT TPLSSSSSKG  60
YYLQDFHHLD DDDDDQIQVN VSSSSWNPVF GVNAACYDPF DAFPYGCSTN RVDFYECKPF  120
AADHNTGNLR HGHVMDKFQS SVGLLNLRNT ISNDVIMMGS DVGYLPSFEF PNLGDEVSCV  180
TAENGYRVLV DSTSSRIRTN WKGRKKTNGV KGQWTMEEDR MLIQLVEQYG VRKWSHIAQM  240
LPGRIGKQCR ERWHNHLRPD IKKDTWSEEE DKVLIQAHIE IGNKWAEIAK RLPGRTENSI  300
KNHWNATKRR QFSKRKCRSK YPRGSILQEY IKSLNLDSTA AAAARSHEKA SDGAAVKAAD  360
NKSSSIKQPQ GLEIGPSTDR LVPEYEYDEV HEFSFDEKLL QESCSIELLL DQIPSTAATA  420
DEKSFQMEDM GAVKNEMDLV EMISAHPNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-452103113104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6501060.0HQ650106.1 Gossypium hirsutum clone BAC 067L14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440417.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-99MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D2RPR60.0A0A0D2RPR6_G
STRINGGLYMA05G02300.21e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-99myb domain protein 98